Vergleich

Prnp Antibody - middle region

ArtNr ARP63174_P050
Hersteller AVIVA Systems Biology
Menge 100 ul
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB, IHC
Specific against Human (Homo sapiens), Rat (Rattus norvegicus), Goat (Caprine, Capra aegagrus hircus), Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Cow (Bos taurus)
Host Rabbit
Sequence GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF
Protein Familie Anti-Prnp Antibody
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias P,S,PrP,PrPC,Sinc,CD230,PrPSc,Prn-i,Prn-p,PrP<C>,AA960666,AI325101,prP27-30,prP33-35C
Similar products PrP, CD230, AA960666, AI325101, PrP, PrPC, PrPSc, Prn-i, Prn-p, Sinc, prP27-30, prP33-35C
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Apoptosis, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
28kDa
Species Tested
Human, Mouse
Gene symbol
PRNP
Gene Fullname
prion protein
Protein size
254
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
Dpp6; Eri3; Syn1; Grb2; Opcml; Lsamp; Ntm; Atp1a3; Igsf8; Cadm3; Clstn1; Pde10a; Adam23; Ywhaz; Ywhae; Stxbp1; Plp1; P4hb; Ncam2; Ncam1; Mog; Mbp; Mag; L1cam; Hspa5; Gnb1; Sparcl1; Dnm1; Dpysl2; Cntn1; Clu; Atp2b2; Atp1b1; Atp1a1; App; Apoe; Aplp2; Apbb1;
Description of target
Prnp may play a role in neuronal development and synaptic plasticity, may be required for neuronal myelin sheath maintenance and may play a role in iron uptake and iron homeostasis. Prnp is a soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. It also provides Cu2+ or ZN2+ for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains.
Nucleotide accession_num
NM_011170
Protein accession_num
NP_035300
Protein name
Major prion protein
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse Prnp
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Human: 100%; Rat: 100%; Sheep: 100%
Concentration
0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen