Comparison

Prnp Antibody - middle region

Item no. ARP63174_P050
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, IHC
Specific against Human (Homo sapiens), Rat (Rattus norvegicus), Goat (Caprine, Capra aegagrus hircus), Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Cow (Bos taurus)
Host Rabbit
Sequence GGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHF
Protein Family Anti-Prnp Antibody
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias P,S,PrP,PrPC,Sinc,CD230,PrPSc,Prn-i,Prn-p,PrP<C>,AA960666,AI325101,prP27-30,prP33-35C
Similar products PrP, CD230, AA960666, AI325101, PrP, PrPC, PrPSc, Prn-i, Prn-p, Sinc, prP27-30, prP33-35C
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Apoptosis, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
28kDa
Species Tested
Human, Mouse
Gene symbol
PRNP
Gene Fullname
prion protein
Protein size
254
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
Dpp6; Eri3; Syn1; Grb2; Opcml; Lsamp; Ntm; Atp1a3; Igsf8; Cadm3; Clstn1; Pde10a; Adam23; Ywhaz; Ywhae; Stxbp1; Plp1; P4hb; Ncam2; Ncam1; Mog; Mbp; Mag; L1cam; Hspa5; Gnb1; Sparcl1; Dnm1; Dpysl2; Cntn1; Clu; Atp2b2; Atp1b1; Atp1a1; App; Apoe; Aplp2; Apbb1;
Description of target
Prnp may play a role in neuronal development and synaptic plasticity, may be required for neuronal myelin sheath maintenance and may play a role in iron uptake and iron homeostasis. Prnp is a soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. It also provides Cu2+ or ZN2+ for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains.
Nucleotide accession_num
NM_011170
Protein accession_num
NP_035300
Protein name
Major prion protein
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse Prnp
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Human: 100%; Rat: 100%; Sheep: 100%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close