« Zurück
Startseite /
GTF2H2 Antibody - middle region

GTF2H2 Antibody - middle region

ArtNr	P100894_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Neuroscience Neural Transcription Factors Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio)
Host	Rabbit
Sequence	HHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCD
Citations	Ren,P., (2007) Am. J. Respir. Crit. Care Med. 175 (11), 1151-1157
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	p44,BTF2,TFIIH,BTF2P44,T-BTF2P44
Similar products	GTF2H2
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/DNA Repair, Root Catalog/Research Areas/GPCR, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	44kDa
Species Tested	Human
Gene symbol	GTF2H2
Gene Fullname	General transcription factor IIH, polypeptide 2, 44kDa
Protein size	395
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; CDK7; GTF2H5; GTF2H1; SRA1; GTF2H4; GTF2H3; UBD; COPS2; ERCC3; ERCC8; ERCC2; AR; MNAT1; CCNH;
Description of target	GTF2H2 gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence hav
Subunit	2
Nucleotide accession_num	NM_001515
Protein accession_num	NP_001506
Protein name	General transcription factor IIH subunit 2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human GTF2H2
Homology	Dog: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Zebrafish: 85%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 11.12.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern