« Zurück
Startseite /
FLJ20729 Antibody - C-terminal region

FLJ20729 Antibody - C-terminal region

ArtNr	ARP34573_T100
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Neuroscience Neural Lineage Markers Antibodies Immunohistochemistry Western Blot Primary Antibodies Neurodegeneration Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	PISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVK
Citations	Scanlan,M.J., et al., (2001) (er) Cancer Immun. 1, 4
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	BCD1,C1orf181,NY-BR-75
Similar products	FLJ20729
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	54kDa
Species Tested	Human
Gene symbol	ZNHIT6
Gene Fullname	Zinc finger, HIT-type containing 6
Protein size	470
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; SMAD2; SIRT1; ELAVL1; SUMO2; Nhp2l1;
Description of target	TRMT1 is a tRNA(m(2)(2)G(26))dimethyltransferase
Nucleotide accession_num	NM_017953
Protein accession_num	NP_060423
Protein name	Box C/D snoRNA protein 1
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ20729
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 83%; Rabbit: 100%; Rat: 100%
Concentration	1.0 mg/ml
Sample Type Confirmation	ZNHIT6 is supported by BioGPS gene expression data to be expressed in Jurkat

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 29.01.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern