« Zurück
Startseite /
SLC38A2 antibody - N-terminal region (ARP33058_T100)

SLC38A2 antibody - N-terminal region (ARP33058_T100)

ArtNr	ARP33058_T100
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Antibodies Western Blot Cardiovascular Research Atherosclerosis Primary Antibodies
Typ	Antibody Polyclonal
Format	Lyophilized
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine)
Host	Rabbit
Sequence	SSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEF
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ATA2,SAT2,SNAT2,PRO1068
Similar products	SLC38A2
Lieferbar
Molecular Weight	56kDa
Description	This is a rabbit polyclonal antibody against SLC38A2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire.
Gene symbol	SLC38A2
Protein size	506
Product format	Lyophilized powder
Reconstitution and storage	Add 100 ul of distilled water. Final anti-SLC38A2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Partner proteins	STX11, STX11
Description of target	Under hypertonic conditions the induction of SLC38A2/SNAT2 leads to the stimulation of transport system A and to the increase in the cell content of amino acids. Its amino acid response element, along with a nearby conserved CAAT box, has enhancer activity in that it functions in an orientation and position independent manner, and it confers regulated transcription to a heterologous promoter.
Nucleotide accession_num	NM_018976
Protein accession_num	http://www.ncbi.nlm.nih.gov/protein/NP_061849
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC38A2 antibody: synthetic peptide directed towards the N terminal of human SLC38A2
Predicted Homology Based on Immunogen Sequence	Dog, Horse, Human, Mouse, Rabbit, Chicken, Guinea pig

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern