« Back
Home /
SLC38A2 antibody - N-terminal region (ARP33058_T100)

SLC38A2 antibody - N-terminal region (ARP33058_T100)

Item no.	ARP33058_T100
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Antibodies Western Blot Cardiovascular Research Atherosclerosis Primary Antibodies
Type	Antibody Polyclonal
Format	Lyophilized
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine)
Host	Rabbit
Sequence	SSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEF
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ATA2,SAT2,SNAT2,PRO1068
Similar products	SLC38A2
Available
Molecular Weight	56kDa
Description	This is a rabbit polyclonal antibody against SLC38A2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire.
Gene symbol	SLC38A2
Protein size	506
Product format	Lyophilized powder
Reconstitution and storage	Add 100 ul of distilled water. Final anti-SLC38A2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Partner proteins	STX11, STX11
Description of target	Under hypertonic conditions the induction of SLC38A2/SNAT2 leads to the stimulation of transport system A and to the increase in the cell content of amino acids. Its amino acid response element, along with a nearby conserved CAAT box, has enhancer activity in that it functions in an orientation and position independent manner, and it confers regulated transcription to a heterologous promoter.
Nucleotide accession_num	NM_018976
Protein accession_num	http://www.ncbi.nlm.nih.gov/protein/NP_061849
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC38A2 antibody: synthetic peptide directed towards the N terminal of human SLC38A2
Predicted Homology Based on Immunogen Sequence	Dog, Horse, Human, Mouse, Rabbit, Chicken, Guinea pig

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer