« Zurück
Startseite /
Axin1 Antibody - N-terminal region

Axin1 Antibody - N-terminal region

ArtNr	ARP42875_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Neural Mitochondrial Function Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Signaling Protein Aggregation, Clearance & Misfolding Neural Adhesion Molecules Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Status Apoptosis Adenocarcinoma Western Blot Primary Antibodies Astrocytoma By Organ Bladder Cancer Colorectal Cancer Breast Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	TVGRDQALGARQAERPWPPHSHPSTPEPSVRNDGKRRFMGVRRQGSRGAG
Protein Familie	Map3k1,APC2,Apc,Axin1,CTNNB1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Fu,Kb,Ki,Axin,fused,kinky,knobbly,AI316800
Similar products	AI316800, Axin, Fu, Kb, Ki, fused, kinky, knobbly
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Apoptosis
Shipping Temperature	Wet Ice
Molecular Weight	110kDa
Species Tested	Mouse
Gene symbol	AXIN1
Protein size	993
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Lrp5; Gsk3b; Prmt1; Ctnnb1; GSK3A; Trp53; Hipk2; Nck2; Lrrk2; ITCH; WWP1; MAP3K1; Kif3a; Cops2; Dvl2; Axin1; Apc; Dixdc1; Ppp2r1a; Map3k4; Ppp2ca; Rnf111; Rnf11; Smad7; Smad6; Smad3; Dvl1; Cdh2; APC2;
Description of target	Axin1 is a component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Axin1 controls dorsoventral patterning via two opposing effects; down-regulates beta-catenin to inhibit the Wnt signaling pathway and ventralize embryos, but also dorsalizes embryos by activating a Wnt-independent JNK signaling pathway. It also facilitates the phosphorylation of APC by GSK3B, facilitates the phosphorylation of TP53 by HIPK2 upon ultraviolet irradiation and enhances TGF-beta signaling by recruiting the RNF111 E3 ubiquitin ligase and promoting the degradation of inhibitory SMAD7.
Nucleotide accession_num	XM_914907
Protein accession_num	XP_920000
Protein name	Axin-1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Axin1
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 29.01.2026

Express-Lieferung: 15 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern