Comparison

Axin1 Antibody - N-terminal region

Item no. ARP42875_P050
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Rabbit
Sequence TVGRDQALGARQAERPWPPHSHPSTPEPSVRNDGKRRFMGVRRQGSRGAG
Protein Family Map3k1,APC2,Apc,Axin1,CTNNB1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Fu,Kb,Ki,Axin,fused,kinky,knobbly,AI316800
Similar products AI316800, Axin, Fu, Kb, Ki, fused, kinky, knobbly
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Apoptosis
Shipping Temperature
Wet Ice
Molecular Weight
110kDa
Species Tested
Mouse
Gene symbol
AXIN1
Protein size
993
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
Lrp5; Gsk3b; Prmt1; Ctnnb1; GSK3A; Trp53; Hipk2; Nck2; Lrrk2; ITCH; WWP1; MAP3K1; Kif3a; Cops2; Dvl2; Axin1; Apc; Dixdc1; Ppp2r1a; Map3k4; Ppp2ca; Rnf111; Rnf11; Smad7; Smad6; Smad3; Dvl1; Cdh2; APC2;
Description of target
Axin1 is a component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Axin1 controls dorsoventral patterning via two opposing effects; down-regulates beta-catenin to inhibit the Wnt signaling pathway and ventralize embryos, but also dorsalizes embryos by activating a Wnt-independent JNK signaling pathway. It also facilitates the phosphorylation of APC by GSK3B, facilitates the phosphorylation of TP53 by HIPK2 upon ultraviolet irradiation and enhances TGF-beta signaling by recruiting the RNF111 E3 ubiquitin ligase and promoting the degradation of inhibitory SMAD7.
Nucleotide accession_num
XM_914907
Protein accession_num
XP_920000
Protein name
Axin-1
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Axin1
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close