« Zurück
Startseite /
DPP6 Antibody - middle region

DPP6 Antibody - middle region

ArtNr	ARP90432_P050
Hersteller	AVIVA Systems Biology
Menge	100 ul
Kategorie	Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	VEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIF
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	R,Pe,Rw,Dpp,Dpp-6,Peplb,D5Buc3,D5Buc4,D5Buc5,DPP VI,Gm1377,In(5)6,In(5)6H-p,B930011P16Rik
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Ion Channel, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	91 kDa
Gene symbol	DPP6
Gene Fullname	dipeptidylpeptidase 6
Protein size	804
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Promotes cell surface expression of the potassium channel KCND2. Modulates the activity and gating characteristics of the potassium channel KCND2. Has no dipeptidyl aminopeptidase activity (By similarity).
Nucleotide accession_num	NM_010075.2
Protein accession_num	NP_034205.1
Protein name	dipeptidyl aminopeptidase-like protein 6
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of mouse DPP6
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern