« Back
Home /
DPP6 Antibody - middle region

DPP6 Antibody - middle region

Item no.	ARP90432_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	VEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIF
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	R,Pe,Rw,Dpp,Dpp-6,Peplb,D5Buc3,D5Buc4,D5Buc5,DPP VI,Gm1377,In(5)6,In(5)6H-p,B930011P16Rik
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Ion Channel, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	91 kDa
Gene symbol	DPP6
Gene Fullname	dipeptidylpeptidase 6
Protein size	804
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Promotes cell surface expression of the potassium channel KCND2. Modulates the activity and gating characteristics of the potassium channel KCND2. Has no dipeptidyl aminopeptidase activity (By similarity).
Nucleotide accession_num	NM_010075.2
Protein accession_num	NP_034205.1
Protein name	dipeptidyl aminopeptidase-like protein 6
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of mouse DPP6
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer