Vergleich

Smad2/3 Antibody (Phospho-Thr8)

ArtNr OAAF07593
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias hMAD-2;hMAD-3;hSMAD2;hSMAD3;HSPC193;HsT17436;JV15-2;JV18;JV18-1;LDS1C;LDS3;MAD homolog 2;MAD homolog 3;mad homolog JV15-2;mad protein homolog;MAD,mothers against decapentaplegic homolog 3;mad3;MADH2;MADH3;MADR2;Mad-related protein 2;mother against DPP homolog 2;mothers against decapentaplegic homolog 2;mothers against decapentaplegic homolog 3;mothers against DPP homolog 3;Sma- and Mad-related protein 2;SMA- and MAD-related protein 3;SMAD family member 2;SMAD family member 3;SMAD,mothers against DPP homolog 2;SMAD,mothers against DPP homolog 3.
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Manufacturer - Targets
Phospho Modification Sites: H:T8, M:T8, R:T8
Shipping Temperature
Wet Ice
Molecular Weight
48 kDa
Manufacturer - Application Additional Information
WB: 1:500~1000
ELISA: 1:10000
Gene symbol
SMAD2|SMAD3
Gene Fullname
SMAD family member 2|SMAD family member 3
Product format
Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Reconstitution and storage
-20°C
Description of target
Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD2/SMAD4 complex, activates transcription. May act as a tumor suppressor in colorectal carcinoma. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.|Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.
Protein name
Mothers against decapentaplegic homolog 2|Mothers against decapentaplegic homolog 3
Clonality
Polyclonal
Purification
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from human Smad2/3 around the phosphorylation site of Thr8.
Manufacturer - Specificity
Smad2/3 (Phospho-Thr8) Antibody detects endogenous levels of Smad2/3 only when phosphorylated at Thr8.
Concentration
1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen