Comparison

Smad2/3 Antibody (Phospho-Thr8)

Item no. OAAF07593
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Isotype IgG
Sequence MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias hMAD-2;hMAD-3;hSMAD2;hSMAD3;HSPC193;HsT17436;JV15-2;JV18;JV18-1;LDS1C;LDS3;MAD homolog 2;MAD homolog 3;mad homolog JV15-2;mad protein homolog;MAD,mothers against decapentaplegic homolog 3;mad3;MADH2;MADH3;MADR2;Mad-related protein 2;mother against DPP homolog 2;mothers against decapentaplegic homolog 2;mothers against decapentaplegic homolog 3;mothers against DPP homolog 3;Sma- and Mad-related protein 2;SMA- and MAD-related protein 3;SMAD family member 2;SMAD family member 3;SMAD,mothers against DPP homolog 2;SMAD,mothers against DPP homolog 3.
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Manufacturer - Targets
Phospho Modification Sites: H:T8, M:T8, R:T8
Shipping Temperature
Wet Ice
Molecular Weight
48 kDa
Manufacturer - Application Additional Information
WB: 1:500~1000
ELISA: 1:10000
Gene symbol
SMAD2|SMAD3
Gene Fullname
SMAD family member 2|SMAD family member 3
Product format
Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Reconstitution and storage
-20°C
Description of target
Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD2/SMAD4 complex, activates transcription. May act as a tumor suppressor in colorectal carcinoma. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.|Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regulate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modulating both growth and migration of primary keratinocytes and by altering the TGF-mediated chemotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. Regulator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.
Protein name
Mothers against decapentaplegic homolog 2|Mothers against decapentaplegic homolog 3
Clonality
Polyclonal
Purification
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from human Smad2/3 around the phosphorylation site of Thr8.
Manufacturer - Specificity
Smad2/3 (Phospho-Thr8) Antibody detects endogenous levels of Smad2/3 only when phosphorylated at Thr8.
Concentration
1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close