Vergleich

Neutrophil Cytosol Factor 1 Antibody (Phospho-Ser328)

ArtNr OAAF07638
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, IHC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Cattle (Bovine)
Host Rabbit
Sequence RRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias 47 kDa autosomal chronic granulomatous disease protein;47 kDa neutrophil oxidase factor;CGD1;NADPH oxidase organizer 2;NCF-1;NCF1A;NCF-47K;neutrophil cytosol factor 1;neutrophil cytosolic factor 1,(chronic granulomatous disease,autosomal 1);neutrophil NADPH oxidase factor 1;nox organizer 2;NOXO2;nox-organizing protein 2;p47phox;p47-phox;SH3 and PX domain-containing protein 1A;SH3PXD1A.
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
44 kDa
Manufacturer - Application Additional Information

IHC: 1:50~1:100
ELISA: 1:1000
Gene symbol
NCF1
Gene Fullname
neutrophil cytosolic factor 1
Reconstitution and storage
-20°C
Description of target
NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production).
Protein name
Neutrophil cytosol factor 1
Clonality
Polyclonal
Purification
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from human Neutrophil Cytosol Factor 1 around the phosphorylation site of Ser328.
Manufacturer - Specificity
Neutrophil Cytosol Factor 1 (Phospho-Ser328) Antibody detects endogenous levels of Neutrophil Cytosol Factor 1 only when phosphorylated at Ser328.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen