« Back
Home /
Neutrophil Cytosol Factor 1 Antibody (Phospho-Ser328)

Neutrophil Cytosol Factor 1 Antibody (Phospho-Ser328)

Item no.	OAAF07638
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Molecular Targets for Neuroscience Antibodies Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Type	Antibody Polyclonal
Applications	WB, IF, IHC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Cattle (Bovine)
Host	Rabbit
Sequence	RRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	47 kDa autosomal chronic granulomatous disease protein;47 kDa neutrophil oxidase factor;CGD1;NADPH oxidase organizer 2;NCF-1;NCF1A;NCF-47K;neutrophil cytosol factor 1;neutrophil cytosolic factor 1,(chronic granulomatous disease,autosomal 1);neutrophil NADPH oxidase factor 1;nox organizer 2;NOXO2;nox-organizing protein 2;p47phox;p47-phox;SH3 and PX domain-containing protein 1A;SH3PXD1A.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	44 kDa
Manufacturer - Application Additional Information	IHC: 1:50~1:100 ELISA: 1:1000
Gene symbol	NCF1
Gene Fullname	neutrophil cytosolic factor 1
Reconstitution and storage	-20°C
Description of target	NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production).
Protein name	Neutrophil cytosol factor 1
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human Neutrophil Cytosol Factor 1 around the phosphorylation site of Ser328.
Manufacturer - Specificity	Neutrophil Cytosol Factor 1 (Phospho-Ser328) Antibody detects endogenous levels of Neutrophil Cytosol Factor 1 only when phosphorylated at Ser328.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAF07638-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/8/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer