« Zurück
Startseite /
VHL Antibody (Phospho-Ser68)

VHL Antibody (Phospho-Ser68)

ArtNr	OAAF07854
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Metabolism Diabetes Glucose Homeostasis Antibodies By Cell Type Carcinoma Obesity Immunohistochemistry Western Blot ELISA Immunofluorescence Cardiovascular Research Heart Failure Myocardial Infarction Hypertension Primary Antibodies Arrhythmias Immunostaining
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IF, IHC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	GAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRV
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	elongin binding protein;HRCA1;protein G7;pVHL;RCA1;VHL1;von Hippel-Lindau disease tumor suppressor;von Hippel-Lindau tumor suppressor,E3 ubiquitin protein ligase.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	24 kDa
Manufacturer - Application Additional Information	IHC: 1:50~1:100 ELISA: 1:10000
Gene symbol	VHL
Gene Fullname	von Hippel-Lindau tumor suppressor
Product format	Liquid. Supplied in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Reconstitution and storage	-20°C
Description of target	Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2.
Protein name	von Hippel-Lindau disease tumor suppressor
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human VHL around the phosphorylation site of Ser68.
Manufacturer - Specificity	VHL (Phospho-Ser68) Antibody detects endogenous levels of VHL only when phosphorylated at Ser68.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAF07854-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern