Vergleich

ARHGDIA Antibody

ArtNr OAAF07880
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Polyclonal
Applikationen IF, IHC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence DKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDH
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias epididymis secretory sperm binding protein Li 47e;GDIA1;GDP-dissociation inhibitor,aplysia RAS-related 1;HEL-S-47e;NPHS8;Rho GDP dissociation inhibitor (GDI) alpha;rho GDP-dissociation inhibitor 1;RHOGDI;Rho-GDI alpha;RHOGDI-1.
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
23 kDa
Manufacturer - Application Additional Information

IHC: 1:50~1:100
ELISA: 1:5000
Gene symbol
ARHGDIA
Gene Fullname
Rho GDP dissociation inhibitor alpha
Reconstitution and storage
-20°C
Description of target
Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1.
Protein name
Rho GDP-dissociation inhibitor 1
Clonality
Polyclonal
Purification
The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
Immunogen
The antiserum was produced against synthesized peptide derived from human ARHGDIA.
Manufacturer - Specificity
ARHGDIA Antibody detects endogenous levels of total ARHGDIA protein.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen