Comparison

ARHGDIA Antibody

Item no. OAAF07880
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Applications IF, IHC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence DKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDH
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias epididymis secretory sperm binding protein Li 47e;GDIA1;GDP-dissociation inhibitor,aplysia RAS-related 1;HEL-S-47e;NPHS8;Rho GDP dissociation inhibitor (GDI) alpha;rho GDP-dissociation inhibitor 1;RHOGDI;Rho-GDI alpha;RHOGDI-1.
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
23 kDa
Manufacturer - Application Additional Information

IHC: 1:50~1:100
ELISA: 1:5000
Gene symbol
ARHGDIA
Gene Fullname
Rho GDP dissociation inhibitor alpha
Reconstitution and storage
-20°C
Description of target
Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1.
Protein name
Rho GDP-dissociation inhibitor 1
Clonality
Polyclonal
Purification
The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
Immunogen
The antiserum was produced against synthesized peptide derived from human ARHGDIA.
Manufacturer - Specificity
ARHGDIA Antibody detects endogenous levels of total ARHGDIA protein.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close