PTGDR2 Antibody

ArtNr	OAAF08137
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Status Adenocarcinoma Mesothelioma Immunohistochemistry Western Blot ELISA Immunofluorescence Autophagy Cardiovascular Research Proliferation Heart Failure Myocardial Infarction Primary Antibodies Immunostaining
Typ	Antibody Polyclonal
Applikationen	WB, IF, IHC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	LNTVPYFVFRDTISRLDGRIMCYYNVLLLNPGPDRDATCNSRQVALAVSK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CD294;chemoattractant receptor homologous molecule expressed on T helper type 2 cells;chemoattractant receptor-homologous molecule expressed on TH2 cells;CRTH2;DL1R;DP2;GPR44;G-protein coupled receptor 44;prostaglandin D2 receptor 2;putative G-protein coupled receptor 44.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	43 kDa
Manufacturer - Application Additional Information	WB: 1:500~1:1000 ELISA: 1:10000
Gene symbol	PTGDR2
Gene Fullname	prostaglandin D2 receptor 2
Reconstitution and storage	-20°C
Description of target	Receptor for prostaglandin D2 (PGD2). Coupled to the G(i)-protein. Receptor activation may result in pertussis toxin-sensitive decreases in cAMP levels and Ca(2+) mobilization. PI3K signaling is also implicated in mediating PTGDR2 effects. PGD2 induced receptor internalization. CRTH2 internalization can be regulated by diverse kinases such as, PKC, PKA, GRK2, GPRK5/GRK5 and GRK6. Receptor activation is responsible, at least in part, in immune regulation and allergic/inflammation responses.
Protein name	Prostaglandin D2 receptor 2
Clonality	Polyclonal
Purification	The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from the Internal region of human PTGDR2.
Manufacturer - Specificity	PTGDR2 Antibody detects endogenous levels of PTGDR2 protein.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAF08137-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern