KLF13 Antibody

ArtNr	OAAF08226
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Metabolism Diabetes Aging & Neurological Disorders Neural Epigenetics Antibodies By Cell Type Carcinoma Hematology Lymphoma Melanoma Sarcoma Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Typ	Antibody Polyclonal
Applikationen	WB, IF, IHC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	LEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	basic transcription element binding protein 3;Basic transcription element-binding protein 3;BTEB3;BTE-binding protein 3;FKLF2;Krueppel-like factor 13;novel Sp1-like zinc finger transcription factor 1;NSLP1;RANTES factor of late activated T lymphocytes-1;RANTES factor of late activated T-lymphocytes 1;RFLAT1;RFLAT-1;transcription factor BTEB3;transcription factor NSLP1.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	31 kDa
Manufacturer - Application Additional Information	WB: 1:500~1:1000 ELISA: 1:10000
Gene symbol	KLF13
Gene Fullname	Kruppel like factor 13
Reconstitution and storage	-20°C
Description of target	Represses transcription by binding to the BTE site, a GC-rich DNA element, in competition with the activator SP1. It also represses transcription by interacting with the corepressor Sin3A and HDAC1. Activates RANTES expression in T-cells.
Protein name	Krueppel-like factor 13
Clonality	Polyclonal
Purification	The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human KLF13 around the non-acetylation site of Lys166.
Manufacturer - Specificity	KLF13 Antibody detects endogenous levels of KLF13166 protein.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAF08226-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern