Comparison

KLF13 Antibody

Item no. OAAF08226
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Applications WB, IF, IHC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Rabbit
Sequence LEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGK
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias basic transcription element binding protein 3;Basic transcription element-binding protein 3;BTEB3;BTE-binding protein 3;FKLF2;Krueppel-like factor 13;novel Sp1-like zinc finger transcription factor 1;NSLP1;RANTES factor of late activated T lymphocytes-1;RANTES factor of late activated T-lymphocytes 1;RFLAT1;RFLAT-1;transcription factor BTEB3;transcription factor NSLP1.
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
31 kDa
Manufacturer - Application Additional Information
WB: 1:500~1:1000
ELISA: 1:10000
Gene symbol
KLF13
Gene Fullname
Kruppel like factor 13
Reconstitution and storage
-20°C
Description of target
Represses transcription by binding to the BTE site, a GC-rich DNA element, in competition with the activator SP1. It also represses transcription by interacting with the corepressor Sin3A and HDAC1. Activates RANTES expression in T-cells.
Protein name
Krueppel-like factor 13
Clonality
Polyclonal
Purification
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from human KLF13 around the non-acetylation site of Lys166.
Manufacturer - Specificity
KLF13 Antibody detects endogenous levels of KLF13166 protein.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close