BNIP1 Antibody

ArtNr	OAAL00029
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Antibodies By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Cell Biology Cell Status Apoptosis Western Blot ELISA Immunofluorescence Autophagy Primary Antibodies By Organ Colorectal Cancer Testicular & Prostate Cancer Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, IF, ELISA
Clon	1G7
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	BCL2/adenovirus E1B 19 kDa protein-interacting protein 1;BCL2/adenovirus E1B 19kDa interacting protein 1;NIP1;SEC20;transformation-related gene 8 protein;TRG-8;vesicle transport protein SEC20.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	BNIP1
Gene Fullname	BCL2 interacting protein 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq
Nucleotide accession_num	BC010959
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH10959
Protein name	BCL2/adenovirus E1B 19kDa interacting protein 1 [Homo sapiens]\|Homo sapiens BCL2/adenovirus E1B 19kDa interacting protein 1, mRNA (cDNA clone MGC:13644 IMAGE:4052817), complete cds
Clonality	Monoclonal
Immunogen	BNIP1 (AAH10959, 1 a.a. ~ 228 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00029-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern