« Back
Home /
BNIP1 Antibody

BNIP1 Antibody

Item no.	OAAL00029
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Antibodies By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Cell Biology Cell Status Apoptosis Western Blot ELISA Immunofluorescence Autophagy Primary Antibodies By Organ Colorectal Cancer Testicular & Prostate Cancer Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IF, ELISA
Clone	1G7
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	BCL2/adenovirus E1B 19 kDa protein-interacting protein 1;BCL2/adenovirus E1B 19kDa interacting protein 1;NIP1;SEC20;transformation-related gene 8 protein;TRG-8;vesicle transport protein SEC20.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	BNIP1
Gene Fullname	BCL2 interacting protein 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq
Nucleotide accession_num	BC010959
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH10959
Protein name	BCL2/adenovirus E1B 19kDa interacting protein 1 [Homo sapiens]\|Homo sapiens BCL2/adenovirus E1B 19kDa interacting protein 1, mRNA (cDNA clone MGC:13644 IMAGE:4052817), complete cds
Clonality	Monoclonal
Immunogen	BNIP1 (AAH10959, 1 a.a. ~ 228 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00029-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer