EFNA3 Antibody

ArtNr	OAAL00087
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Neural Lineage Markers Antibodies Immunoprecipitation Western Blot ELISA Primary Antibodies Immunostaining Stem Cell Markers
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	IP, ELISA
Clon	1C12
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	EFL2;EFL-2;EHK1 ligand;Ehk1-L;eph-related receptor tyrosine kinase ligand 3;ephrin-A3;EPLG3;LERK3;LERK-3;ligand of eph-related kinase 3.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	EFNA3
Gene Fullname	ephrin A3
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq
Nucleotide accession_num	BC017722
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH17722
Protein name	Ephrin-A3 [Homo sapiens]\|Homo sapiens ephrin-A3, mRNA (cDNA clone MGC:21335 IMAGE:4397263), complete cds
Clonality	Monoclonal
Immunogen	EFNA3 (AAH17722, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00087-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern