Comparison

EFNA3 Antibody

Item no. OAAL00087
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications IP, ELISA
Clone 1C12
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Mouse
Isotype IgG1 Kappa
Sequence MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias EFL2;EFL-2;EHK1 ligand;Ehk1-L;eph-related receptor tyrosine kinase ligand 3;ephrin-A3;EPLG3;LERK3;LERK-3;ligand of eph-related kinase 3.
Shipping Condition Cool pack
Available
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
EFNA3
Gene Fullname
ephrin A3
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq
Nucleotide accession_num
BC017722
Protein accession_num
https://www.ncbi.nlm.nih.gov/protein/AAH17722
Protein name
Ephrin-A3 [Homo sapiens]|Homo sapiens ephrin-A3, mRNA (cDNA clone MGC:21335 IMAGE:4397263), complete cds
Clonality
Monoclonal
Immunogen
EFNA3 (AAH17722, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close