GTF2H1 Antibody

ArtNr	OAAL00130
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Neural Transcription Factors Antibodies ELISA Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	ELISA
Clon	4B9
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	INQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	basic transcription factor 2 62 kDa subunit;BTF2;BTF2 p62;epididymis secretory sperm binding protein;general transcription factor IIH polypeptide 1;general transcription factor IIH subunit 1;general transcription factor IIH,polypeptide 1,62kDa;P62;TFB1;TFIIH;TFIIH basal transcription factor complex p62 subunit.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	GTF2H1
Gene Fullname	general transcription factor IIH subunit 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	NM_005316
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_005307
Protein name	general transcription factor IIH subunit 1 [Homo sapiens]\|Homo sapiens general transcription factor IIH subunit 1 (GTF2H1), transcript variant 1, mRNA
Clonality	Monoclonal
Immunogen	GTF2H1 (NP_005307, 449 a.a. ~ 548 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00130-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 11.12.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern