« Back
Home /
GTF2H1 Antibody

GTF2H1 Antibody

Item no.	OAAL00130
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Neural Transcription Factors Antibodies ELISA Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	ELISA
Clone	4B9
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	INQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	basic transcription factor 2 62 kDa subunit;BTF2;BTF2 p62;epididymis secretory sperm binding protein;general transcription factor IIH polypeptide 1;general transcription factor IIH subunit 1;general transcription factor IIH,polypeptide 1,62kDa;P62;TFB1;TFIIH;TFIIH basal transcription factor complex p62 subunit.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	GTF2H1
Gene Fullname	general transcription factor IIH subunit 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	NM_005316
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_005307
Protein name	general transcription factor IIH subunit 1 [Homo sapiens]\|Homo sapiens general transcription factor IIH subunit 1 (GTF2H1), transcript variant 1, mRNA
Clonality	Monoclonal
Immunogen	GTF2H1 (NP_005307, 449 a.a. ~ 548 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00130-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer