MEF2B Antibody

ArtNr	OAAL00193
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	4B5
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	LOC729991-MEF2B;LOC729991-MEF2B readthrough;MEF2B;MEF2BNB-MEF2B;MEF2BNB-MEF2B readthrough;myocyte enhancer factor 2B;myocyte-specific enhancer factor 2B;RSRFR2;serum response factor-like protein 2.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	BORCS8-MEF2B
Gene Fullname	BORCS8-MEF2B readthrough
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on geneID:100271849. [provided by RefSeq
Nucleotide accession_num	NM_005919
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_005910.1
Protein name	Homo sapiens BORCS8-MEF2B readthrough (BORCS8-MEF2B), transcript variant 1, mRNA\|myocyte enhancer factor 2B isoform b [Homo sapiens]
Clonality	Monoclonal
Immunogen	MEF2B (NP_005910.1, 165 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00193-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern