Comparison

MEF2B Antibody

Item no. OAAL00193
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, ELISA
Clone 4B5
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Mouse
Isotype IgG2a Kappa
Sequence SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias LOC729991-MEF2B;LOC729991-MEF2B readthrough;MEF2B;MEF2BNB-MEF2B;MEF2BNB-MEF2B readthrough;myocyte enhancer factor 2B;myocyte-specific enhancer factor 2B;RSRFR2;serum response factor-like protein 2.
Shipping Condition Cool pack
Available
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
BORCS8-MEF2B
Gene Fullname
BORCS8-MEF2B readthrough
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on geneID:100271849. [provided by RefSeq
Nucleotide accession_num
NM_005919
Protein accession_num
https://www.ncbi.nlm.nih.gov/protein/NP_005910.1
Protein name
Homo sapiens BORCS8-MEF2B readthrough (BORCS8-MEF2B), transcript variant 1, mRNA|myocyte enhancer factor 2B isoform b [Homo sapiens]
Clonality
Monoclonal
Immunogen
MEF2B (NP_005910.1, 165 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close