MAPK11 Antibody

ArtNr	OAAL00260
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Aging & Neurological Disorders Neural Signaling Antibodies Western Blot ELISA Primary Antibodies CHiP Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	1F9
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	ARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	MAP kinase 11;MAP kinase p38 beta;mitogen-activated protein kinase 11;mitogen-activated protein kinase p38 beta;mitogen-activated protein kinase p38-2;p38-2;P38B;p38Beta;P38BETA2;PRKM11;SAPK2;SAPK2B;stress-activated protein kinase-2;stress-activated protein kinase-2b.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	MAPK11
Gene Fullname	mitogen-activated protein kinase 11
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase. [provided by RefSeq
Nucleotide accession_num	BC027933
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH27933
Protein name	Homo sapiens mitogen-activated protein kinase 11, mRNA (cDNA clone MGC:34566 IMAGE:5199628), complete cds\|Mitogen-activated protein kinase 11 [Homo sapiens]
Clonality	Monoclonal
Immunogen	MAPK11 (AAH27933, 255 a.a. ~ 364 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00260-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern