Comparison

MAPK11 Antibody

Item no. OAAL00260
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, ELISA
Clone 1F9
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Mouse
Isotype IgG2a Kappa
Sequence ARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias MAP kinase 11;MAP kinase p38 beta;mitogen-activated protein kinase 11;mitogen-activated protein kinase p38 beta;mitogen-activated protein kinase p38-2;p38-2;P38B;p38Beta;P38BETA2;PRKM11;SAPK2;SAPK2B;stress-activated protein kinase-2;stress-activated protein kinase-2b.
Shipping Condition Cool pack
Available
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
MAPK11
Gene Fullname
mitogen-activated protein kinase 11
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase. [provided by RefSeq
Nucleotide accession_num
BC027933
Protein accession_num
https://www.ncbi.nlm.nih.gov/protein/AAH27933
Protein name
Homo sapiens mitogen-activated protein kinase 11, mRNA (cDNA clone MGC:34566 IMAGE:5199628), complete cds|Mitogen-activated protein kinase 11 [Homo sapiens]
Clonality
Monoclonal
Immunogen
MAPK11 (AAH27933, 255 a.a. ~ 364 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close