Vergleich

CXCL12 Antibody

ArtNr OAAL00300
Hersteller AVIVA Systems Biology
Menge 100 ug
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen ELISA
Clon 1B2
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Mouse
Isotype IgG2b Kappa
Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias chemokine (C-X-C motif) ligand 12;intercrine reduced in hepatomas;IRH;PBSF;pre-B cell growth-stimulating factor;SCYB12;SDF1;stromal cell-derived factor 1;TLSF;TPAR1.
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
CXCL12
Gene Fullname
C-X-C motif chemokine ligand 12
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
For background information on chemokines, see CXCL1 (MIM 155730). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.[supplied by OMIM
Nucleotide accession_num
BC039893
Protein accession_num
https://www.ncbi.nlm.nih.gov/protein/AAH39893.1
Protein name
Chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) [Homo sapiens]|Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1), mRNA (cDNA clone MGC:47612 IMAGE:5729604), complete cds
Clonality
Monoclonal
Immunogen
CXCL12 (AAH39893.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen