Comparison

CXCL12 Antibody

Item no. OAAL00300
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications ELISA
Clone 1B2
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Mouse
Isotype IgG2b Kappa
Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias chemokine (C-X-C motif) ligand 12;intercrine reduced in hepatomas;IRH;PBSF;pre-B cell growth-stimulating factor;SCYB12;SDF1;stromal cell-derived factor 1;TLSF;TPAR1.
Shipping Condition Cool pack
Available
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
CXCL12
Gene Fullname
C-X-C motif chemokine ligand 12
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
For background information on chemokines, see CXCL1 (MIM 155730). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.[supplied by OMIM
Nucleotide accession_num
BC039893
Protein accession_num
https://www.ncbi.nlm.nih.gov/protein/AAH39893.1
Protein name
Chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) [Homo sapiens]|Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1), mRNA (cDNA clone MGC:47612 IMAGE:5729604), complete cds
Clonality
Monoclonal
Immunogen
CXCL12 (AAH39893.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close