PIK3R3 Antibody

ArtNr	OAAL00400
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Status Adenocarcinoma Mesothelioma Western Blot ELISA Autophagy Cardiovascular Research Proliferation Myocardial Infarction Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	2F8
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	HDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAF
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	p55;p55-GAMMA;p55PIK;phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;phosphatidylinositol 3-kinase regulatory subunit gamma;phosphatidylinositol 3-kinase,regulatory subunit,polypeptide 3 (p55,gamma);phosphoinositide-3-kinase,regulatory subunit 3 (gamma);PI3K regulatory subunit gamma;PI3-kinase regulatory subunit gamma;PI3-kinase subunit p55-gamma;ptdIns-3-kinase regulatory subunit p55-gamma.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Proximity ligation assay\|Western blot
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	PIK3R3
Gene Fullname	phosphoinositide-3-kinase regulatory subunit 3
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	BC021622
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH21622
Protein name	Homo sapiens phosphoinositide-3-kinase, regulatory subunit 3 (gamma), mRNA (cDNA clone MGC:9142 IMAGE:3910221), complete cds\|Phosphoinositide-3-kinase, regulatory subunit 3 (gamma) [Homo sapiens]
Clonality	Monoclonal
Immunogen	PIK3R3 (AAH21622, 271 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00400-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern