« Back
Home /
PIK3R3 Antibody

PIK3R3 Antibody

Item no.	OAAL00400
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Status Adenocarcinoma Mesothelioma Western Blot ELISA Autophagy Cardiovascular Research Proliferation Myocardial Infarction Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	2F8
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	HDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAF
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	p55;p55-GAMMA;p55PIK;phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma;phosphatidylinositol 3-kinase regulatory subunit gamma;phosphatidylinositol 3-kinase,regulatory subunit,polypeptide 3 (p55,gamma);phosphoinositide-3-kinase,regulatory subunit 3 (gamma);PI3K regulatory subunit gamma;PI3-kinase regulatory subunit gamma;PI3-kinase subunit p55-gamma;ptdIns-3-kinase regulatory subunit p55-gamma.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Proximity ligation assay\|Western blot
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	PIK3R3
Gene Fullname	phosphoinositide-3-kinase regulatory subunit 3
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	BC021622
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH21622
Protein name	Homo sapiens phosphoinositide-3-kinase, regulatory subunit 3 (gamma), mRNA (cDNA clone MGC:9142 IMAGE:3910221), complete cds\|Phosphoinositide-3-kinase, regulatory subunit 3 (gamma) [Homo sapiens]
Clonality	Monoclonal
Immunogen	PIK3R3 (AAH21622, 271 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00400-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer