MYST2 Antibody

ArtNr	OAAL00567
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Antibodies Western Blot ELISA Primary Antibodies CHiP Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	2G5
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	HBO1;HBOA;histone acetyltransferase binding to ORC1;histone acetyltransferase KAT7;histone acetyltransferase MYST2;K(lysine) acetyltransferase 7;MOZ,YBF2/SAS3,SAS2 and TIP60 protein 2;MYST histone acetyltransferase 2;MYST2;ZC2HC7.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	KAT7
Gene Fullname	lysine acetyltransferase 7
Product format	Liquid PBS (pH 7.4)
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	BC032640
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH32640
Protein name	Homo sapiens MYST histone acetyltransferase 2, mRNA (cDNA clone MGC:45187 IMAGE:5496142), complete cds\|MYST histone acetyltransferase 2 [Homo sapiens]
Clonality	Monoclonal
Immunogen	MYST2 (AAH32640, 512 a.a. ~ 611 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Concentration	1 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00567-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern