« Back
Home /
MYST2 Antibody

MYST2 Antibody

Item no.	OAAL00567
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Antibodies Western Blot ELISA Primary Antibodies CHiP Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	2G5
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	HBO1;HBOA;histone acetyltransferase binding to ORC1;histone acetyltransferase KAT7;histone acetyltransferase MYST2;K(lysine) acetyltransferase 7;MOZ,YBF2/SAS3,SAS2 and TIP60 protein 2;MYST histone acetyltransferase 2;MYST2;ZC2HC7.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	KAT7
Gene Fullname	lysine acetyltransferase 7
Product format	Liquid PBS (pH 7.4)
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	BC032640
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH32640
Protein name	Homo sapiens MYST histone acetyltransferase 2, mRNA (cDNA clone MGC:45187 IMAGE:5496142), complete cds\|MYST histone acetyltransferase 2 [Homo sapiens]
Clonality	Monoclonal
Immunogen	MYST2 (AAH32640, 512 a.a. ~ 611 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Concentration	1 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00567-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer