FLVCR1 Antibody

ArtNr	OAAL00652
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Antibodies Western Blot ELISA Primary Antibodies CHiP By Organ Heart & Blood Cancer Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	4B2
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2b Kappa
Sequence	MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEEETQARLLP
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	AXPC1;feline leukemia virus subgroup C cellular receptor 1;feline leukemia virus subgroup C receptor-related protein 1;FLVCR;MFSD7B;PCA;PCARP;SLC49A1.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	FLVCR1
Gene Fullname	FLVCR heme transporter 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	NM_014053
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_054772
Protein name	feline leukemia virus subgroup C receptor-related protein 1 [Homo sapiens]\|Homo sapiens feline leukemia virus subgroup C cellular receptor 1 (FLVCR1), mRNA
Clonality	Monoclonal
Immunogen	FLVCR (NP_054772, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00652-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern