« Back
Home /
FLVCR1 Antibody

FLVCR1 Antibody

Item no.	OAAL00652
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Antibodies Western Blot ELISA Primary Antibodies CHiP By Organ Heart & Blood Cancer Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	4B2
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2b Kappa
Sequence	MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEEETQARLLP
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	AXPC1;feline leukemia virus subgroup C cellular receptor 1;feline leukemia virus subgroup C receptor-related protein 1;FLVCR;MFSD7B;PCA;PCARP;SLC49A1.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	FLVCR1
Gene Fullname	FLVCR heme transporter 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	NM_014053
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_054772
Protein name	feline leukemia virus subgroup C receptor-related protein 1 [Homo sapiens]\|Homo sapiens feline leukemia virus subgroup C cellular receptor 1 (FLVCR1), mRNA
Clonality	Monoclonal
Immunogen	FLVCR (NP_054772, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00652-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer