LAP3 Antibody

ArtNr	OAAL00665
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Antibodies By Cell Type Carcinoma Hematology Leukemia Lymphoma Western Blot ELISA Cardiovascular Research Atherosclerosis Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	4G10
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	EASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	cysteinylglycine-S-conjugate dipeptidase;cytosol aminopeptidase;epididymis secretory protein Li 106;HEL-S-106;LAP;LAPEP;leucyl aminopeptidase;PEPS;peptidase S;proline aminopeptidase;prolyl aminopeptidase.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	LAP3
Gene Fullname	leucine aminopeptidase 3
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	NM_015907
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_056991
Protein name	cytosol aminopeptidase [Homo sapiens]\|Homo sapiens leucine aminopeptidase 3 (LAP3), mRNA
Clonality	Monoclonal
Immunogen	LAP3 (NP_056991, 420 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00665-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern