« Back
Home /
LAP3 Antibody

LAP3 Antibody

Item no.	OAAL00665
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Antibodies By Cell Type Carcinoma Hematology Leukemia Lymphoma Western Blot ELISA Cardiovascular Research Atherosclerosis Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	4G10
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	EASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	cysteinylglycine-S-conjugate dipeptidase;cytosol aminopeptidase;epididymis secretory protein Li 106;HEL-S-106;LAP;LAPEP;leucyl aminopeptidase;PEPS;peptidase S;proline aminopeptidase;prolyl aminopeptidase.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	LAP3
Gene Fullname	leucine aminopeptidase 3
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	NM_015907
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_056991
Protein name	cytosol aminopeptidase [Homo sapiens]\|Homo sapiens leucine aminopeptidase 3 (LAP3), mRNA
Clonality	Monoclonal
Immunogen	LAP3 (NP_056991, 420 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00665-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer