LCMT1 Antibody

ArtNr	OAAL00688
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Neuroscience Neural Epigenetics Protein Aggregation, Clearance & Misfolding Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, ELISA
Clon	3D3
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	MATRQRESSITSCCSTSSCDADDEGVRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVHGVSQLIKAFLRKTECHCQIVNLGAGMDTTFWRLKDEDLLPSKYFEVDFPMIVTRKLHSIKCKPPLSSPILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGV
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	[Phosphatase 2A protein]-leucine-carboxy methyltransferase 1;CGI-68;LCMT;leucine carboxyl methyltransferase 1;PPMT1;protein phosphatase methyltransferase 1;protein-leucine O-methyltransferase.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	LCMT1
Gene Fullname	leucine carboxyl methyltransferase 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	LCMT1 catalyzes the methylation of the carboxyl group of the C-terminal leucine residue (leu309) of the catalytic subunit of protein phosphatase-2A (PPP2CA; MIM 176915) (De Baere et al., 1999 [PubMed 10600115]).[supplied by OMIM
Nucleotide accession_num	BC001214
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH01214
Protein name	Homo sapiens leucine carboxyl methyltransferase 1, mRNA (cDNA clone MGC:682 IMAGE:3533656), complete cds\|Leucine carboxyl methyltransferase 1 [Homo sapiens]
Clonality	Monoclonal
Immunogen	LCMT1 (AAH01214, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00688-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 08.01.2026