« Back
Home /
LCMT1 Antibody

LCMT1 Antibody

Item no.	OAAL00688
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Neural Epigenetics Protein Aggregation, Clearance & Misfolding Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	3D3
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	MATRQRESSITSCCSTSSCDADDEGVRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVHGVSQLIKAFLRKTECHCQIVNLGAGMDTTFWRLKDEDLLPSKYFEVDFPMIVTRKLHSIKCKPPLSSPILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGV
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	[Phosphatase 2A protein]-leucine-carboxy methyltransferase 1;CGI-68;LCMT;leucine carboxyl methyltransferase 1;PPMT1;protein phosphatase methyltransferase 1;protein-leucine O-methyltransferase.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	LCMT1
Gene Fullname	leucine carboxyl methyltransferase 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	LCMT1 catalyzes the methylation of the carboxyl group of the C-terminal leucine residue (leu309) of the catalytic subunit of protein phosphatase-2A (PPP2CA; MIM 176915) (De Baere et al., 1999 [PubMed 10600115]).[supplied by OMIM
Nucleotide accession_num	BC001214
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH01214
Protein name	Homo sapiens leucine carboxyl methyltransferase 1, mRNA (cDNA clone MGC:682 IMAGE:3533656), complete cds\|Leucine carboxyl methyltransferase 1 [Homo sapiens]
Clonality	Monoclonal
Immunogen	LCMT1 (AAH01214, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00688-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/8/2026

Compare

Add to wishlist

Get an offer

Request delivery time