UBASH3B Antibody

ArtNr	OAAL00865
Hersteller	AVIVA Systems Biology
Menge	100 ug
Kategorie	Oncology Neuroscience Neural Signaling Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Lymphoma Myeloma Melanoma Sarcoma Adenocarcinoma Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Astrocytoma By Organ Bladder Cancer Immunostaining
Typ	Antibody Monoclonal
Format	Liquid
Applikationen	WB, IF, IHC, ELISA
Clon	3G7
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2b Kappa
Sequence	DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	cbl-interacting protein p70;Cbl-interacting protein Sts-1;nm23-phosphorylated unknown substrate;p70;SH3 domain-containing 70 kDa protein,suppressor of T-cell receptor signaling 1,nm23-phosphorylated unknown substrate;STS1;STS-1;suppressor of T-cell receptor signaling 1;T-cell ubiquitin ligand 2;TULA2;TULA-2;tyrosine-protein phosphatase STS1/TULA2;ubiquitin-associated and SH3 domain-containing protein B.
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	UBASH3B
Gene Fullname	ubiquitin associated and SH3 domain containing B
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. [provided by RefSeq
Nucleotide accession_num	NM_032873
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_116262.2
Protein name	Homo sapiens ubiquitin associated and SH3 domain containing B (UBASH3B), mRNA\|ubiquitin-associated and SH3 domain-containing protein B [Homo sapiens]
Clonality	Monoclonal
Immunogen	UBASH3B (NP_116262.2, 344 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OAAL00865-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 08.01.2026