« Back
Home /
UBASH3B Antibody

UBASH3B Antibody

Item no.	OAAL00865
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Neural Signaling Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Lymphoma Myeloma Melanoma Sarcoma Adenocarcinoma Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Astrocytoma By Organ Bladder Cancer Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IF, IHC, ELISA
Clone	3G7
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2b Kappa
Sequence	DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	cbl-interacting protein p70;Cbl-interacting protein Sts-1;nm23-phosphorylated unknown substrate;p70;SH3 domain-containing 70 kDa protein,suppressor of T-cell receptor signaling 1,nm23-phosphorylated unknown substrate;STS1;STS-1;suppressor of T-cell receptor signaling 1;T-cell ubiquitin ligand 2;TULA2;TULA-2;tyrosine-protein phosphatase STS1/TULA2;ubiquitin-associated and SH3 domain-containing protein B.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	UBASH3B
Gene Fullname	ubiquitin associated and SH3 domain containing B
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. [provided by RefSeq
Nucleotide accession_num	NM_032873
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_116262.2
Protein name	Homo sapiens ubiquitin associated and SH3 domain containing B (UBASH3B), mRNA\|ubiquitin-associated and SH3 domain-containing protein B [Homo sapiens]
Clonality	Monoclonal
Immunogen	UBASH3B (NP_116262.2, 344 a.a. ~ 441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00865-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/8/2026

Compare

Add to wishlist

Get an offer

Request delivery time