MMP 9 Protein

ArtNr	OOPA00132
Hersteller	AVIVA Systems Biology
Menge	2 ug
Kategorie	Oncology Neuroscience Neuroinflammation By Cell Type Peptides & Proteins Recombinant Proteins Cell Biology Cell Stainings ECM Cardiovascular Research Atherosclerosis
Typ	Proteins Recombinant
Format	Liquid
Specific against	other
Host	Insect Cells, Baculovirus-Infected Insect Cells
Purity	Greater than 90.0% as determined by SDS-PAGE.
Sequence	APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQKHLSLPETG ELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHNITYWIQNYSEDLPRDVIDDAFARAFA LWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEEL WSLGKGVVVPTYFGNADGAPCHFPFTFEGRSYTACTTDGRSDGMAWCSTTADYDTDRRFGF
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Matrix metalloproteinase-9,MMP-9,92 kDa type IV collagenase,92 kDa gelatinase,Gelatinase B,GELB,MMP9,CLG4B.
Similar products	MMP 9
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Others
Manufacturer - Category	Root Catalog/Products/Other, Root Catalog/Products/Recombinant Proteins
Manufacturer - Host	Baculovirus sytem, insect cells.
Shipping Temperature	Wet Ice
Gene symbol	MMP 9
Protein size	Recombinant
Product format	Sterile Filtered clear solution.
Reconstitution and storage	MMP-9 although stable 4C for 4 weeks, should be stored desiccated below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Purification	Greater than 90.0% as determined by SDS-PAGE.
Formulation	The MMP-9 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OOPA00132-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 2 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern