« Back
Home /
MMP 9 Protein

MMP 9 Protein

Item no.	OOPA00132
Manufacturer	AVIVA Systems Biology
Amount	2 ug
Category	Oncology Neuroscience Neuroinflammation By Cell Type Peptides & Proteins Recombinant Proteins Cell Biology Cell Stainings ECM Cardiovascular Research Atherosclerosis
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Host	Insect Cells, Baculovirus-Infected Insect Cells
Purity	Greater than 90.0% as determined by SDS-PAGE.
Sequence	APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQKHLSLPETG ELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHNITYWIQNYSEDLPRDVIDDAFARAFA LWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEEL WSLGKGVVVPTYFGNADGAPCHFPFTFEGRSYTACTTDGRSDGMAWCSTTADYDTDRRFGF
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Matrix metalloproteinase-9,MMP-9,92 kDa type IV collagenase,92 kDa gelatinase,Gelatinase B,GELB,MMP9,CLG4B.
Similar products	MMP 9
Shipping Condition	Cool pack
Available
Manufacturer - Type	Others
Manufacturer - Category	Root Catalog/Products/Other, Root Catalog/Products/Recombinant Proteins
Manufacturer - Host	Baculovirus sytem, insect cells.
Shipping Temperature	Wet Ice
Gene symbol	MMP 9
Protein size	Recombinant
Product format	Sterile Filtered clear solution.
Reconstitution and storage	MMP-9 although stable 4C for 4 weeks, should be stored desiccated below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Purification	Greater than 90.0% as determined by SDS-PAGE.
Formulation	The MMP-9 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OOPA00132-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 2 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer