« Zurück
Startseite /
Human DEFENSIN BETA 2 Protein

Human DEFENSIN BETA 2 Protein

ArtNr	OPSA11014
Hersteller	AVIVA Systems Biology
Menge	20 ug
Kategorie	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Western Blot ELISA Immunostaining Functional Assays
Typ	Proteins Recombinant
Format	Lyophilized
Applikationen	WB, ELISA, FA
Specific against	Human (Homo sapiens)
Purity	>98% by SDS PAGE and HPLC analysis.
Sequence	GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Citations	1. Bals, R. et al. (1998) Human beta-Defensin 2 is a salt-sensitive peptide antibiotic expressed in human lung. J. Clin. Invest. 102: 874-880. 2. Yang, D. et al. (1999) Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6. Science 286: 525-528.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	BD-2,SAP1,DEFB2,DEFB4,HBD-2,DEFB-2,DEFB102
Similar products	DEFB4A
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/GPCR, Root Catalog/Research Areas/Microbiology
Molecular Weight	4.3 kDa (41 amino acid sequence/residues)
Manufacturer - Application Additional Information	ELISA: 0.2 - 0.4 ng/well. Recombinant human BD-2 may be used as a standard in ELISA applications with either a purified human BD-2 antibody or a biotinylated human BD-2 antibody. WB: 1.5 - 3.0 ng/lane. Recombinant human BD-2 may be used as a the positive control in Western Blotting applications with either a purified human BD-2 antibody or a biotinylated human BD-2 antibody. FN: 10 - 100 ng/mL.
Gene symbol	DEFB4A
Protein size	Recombinant
Product format	Lyophilized
Reconstitution and storage	-20°C
Description of target	RECOMBINANT HUMAN DEFENSIN BETA 2 Defensin beta-2 (BD-2), is a member of the beta defensin family, secreted at epithelial surfaces of the skin and respiratory tract and by some leukocytes. BD-2 is induced by bacterial products and cytokines during inflammation and functions as part of the innate immune system, having a wide ranging antimicrobial activity. BD-2 also functions as a chemoattractant to immature dendritic cells and memory T cells and acts as a ligand for TLR4, upregulating co-stimulatory molecules and inducing dendritic cell maturation.
Protein accession_num	NP_004933.1
Protein name	Beta-defensin 4A
Purification	Purified recombinant BD-2, expressed in E. coli
Homology	Human
Preparation	Purified recombinant BD-2, expressed in E. coli
Biological activity	Determined by its ability to chemoattract immature dendritic cells using a concentration of 10.0 - 100.0 ng/ml.
Concentration	0.1 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPSA11014-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern