« Back
Home /
Human DEFENSIN BETA 2 Protein

Human DEFENSIN BETA 2 Protein

Item no.	OPSA11014
Manufacturer	AVIVA Systems Biology
Amount	20 ug
Category	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Western Blot ELISA Immunostaining Functional Assays
Type	Proteins Recombinant
Format	Lyophilized
Applications	WB, ELISA, FA
Specific against	Human (Homo sapiens)
Purity	>98% by SDS PAGE and HPLC analysis.
Sequence	GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Citations	1. Bals, R. et al. (1998) Human beta-Defensin 2 is a salt-sensitive peptide antibiotic expressed in human lung. J. Clin. Invest. 102: 874-880. 2. Yang, D. et al. (1999) Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6. Science 286: 525-528.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	BD-2,SAP1,DEFB2,DEFB4,HBD-2,DEFB-2,DEFB102
Similar products	DEFB4A
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/GPCR, Root Catalog/Research Areas/Microbiology
Molecular Weight	4.3 kDa (41 amino acid sequence/residues)
Manufacturer - Application Additional Information	ELISA: 0.2 - 0.4 ng/well. Recombinant human BD-2 may be used as a standard in ELISA applications with either a purified human BD-2 antibody or a biotinylated human BD-2 antibody. WB: 1.5 - 3.0 ng/lane. Recombinant human BD-2 may be used as a the positive control in Western Blotting applications with either a purified human BD-2 antibody or a biotinylated human BD-2 antibody. FN: 10 - 100 ng/mL.
Gene symbol	DEFB4A
Protein size	Recombinant
Product format	Lyophilized
Reconstitution and storage	-20°C
Description of target	RECOMBINANT HUMAN DEFENSIN BETA 2 Defensin beta-2 (BD-2), is a member of the beta defensin family, secreted at epithelial surfaces of the skin and respiratory tract and by some leukocytes. BD-2 is induced by bacterial products and cytokines during inflammation and functions as part of the innate immune system, having a wide ranging antimicrobial activity. BD-2 also functions as a chemoattractant to immature dendritic cells and memory T cells and acts as a ligand for TLR4, upregulating co-stimulatory molecules and inducing dendritic cell maturation.
Protein accession_num	NP_004933.1
Protein name	Beta-defensin 4A
Purification	Purified recombinant BD-2, expressed in E. coli
Homology	Human
Preparation	Purified recombinant BD-2, expressed in E. coli
Biological activity	Determined by its ability to chemoattract immature dendritic cells using a concentration of 10.0 - 100.0 ng/ml.
Concentration	0.1 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPSA11014-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 1/8/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer