« Zurück
Startseite /
FGF-2 Recombinant Protein (Mouse)

FGF-2 Recombinant Protein (Mouse)

ArtNr	OPCA00637
Hersteller	AVIVA Systems Biology
Menge	10 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Neural Signaling Neural Adhesion Molecules By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Sarcoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines Astrocytoma By Organ Bladder Cancer Calcium Binding Protein Markers Interneuron Markers
Typ	Proteins Recombinant
Format	Liquid
Specific against	Mouse (Murine, Mus musculus)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Citations	Isolation of cDNAs encoding four mouse FGF family members and characterization of their expression patterns during embryogenesis.Hebert J.M., Basilico C., Goldfarb M., Haub O., Martin G.R.Dev. Biol. 138:454-463(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	basic fibroblast growth factor;bFGF;Fgf-2;Fgf2a;Fgfb;fibroblast growth factor 2;fibroblast growth factor 2a;HBGF-2;heparin-binding growth factor 2.
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	20.3 kDa
Gene symbol	Fgf2
Gene Fullname	fibroblast growth factor 2
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis.
Protein name	Fibroblast growth factor 2
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

OPCA00637-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern