« Back
Home /
FGF-2 Recombinant Protein (Mouse)

FGF-2 Recombinant Protein (Mouse)

Item no.	OPCA00637
Manufacturer	AVIVA Systems Biology
Amount	10 ug
Category	Oncology Neuroscience Neural Lineage Markers Neural Signaling Neural Adhesion Molecules By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Sarcoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines Astrocytoma By Organ Bladder Cancer Calcium Binding Protein Markers Interneuron Markers
Type	Proteins Recombinant
Format	Liquid
Specific against	Mouse (Murine, Mus musculus)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Citations	Isolation of cDNAs encoding four mouse FGF family members and characterization of their expression patterns during embryogenesis.Hebert J.M., Basilico C., Goldfarb M., Haub O., Martin G.R.Dev. Biol. 138:454-463(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	basic fibroblast growth factor;bFGF;Fgf-2;Fgf2a;Fgfb;fibroblast growth factor 2;fibroblast growth factor 2a;HBGF-2;heparin-binding growth factor 2.
Available
Manufacturer - Type	Protein
Manufacturer - Category	Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	20.3 kDa
Gene symbol	Fgf2
Gene Fullname	fibroblast growth factor 2
Protein size	Recombinant
Product format	Liquid or Lyophilized powder
Reconstitution and storage	-20°C or -80°C
Description of target	Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis.
Protein name	Fibroblast growth factor 2
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OPCA00637-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 11/27/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer